Thiomonas intermedia: Tint_2389 Help Entry Tint_2389         CDS       T01227                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tin  Thiomonas intermedia Pathway tin01100   Metabolic pathways tin01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tin00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Tint_2389    00074 Mycolic acid biosynthesis     Tint_2389   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Tint_2389 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  ADG31738 UniProt:  D5X4S4 LinkDB All DBs Position complement(2551022..2551261) Genome browser AA seq 79 aa AA seqDB search MSDIEQRVKKIIAEQLGVAEDQVTNEKSFVDDLGADSLDTVELVMALEDEFHIEIPDEDA EKITTVQLAVDYAKAHYKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgacatcgaacagcgcgtcaagaaaatcatcgccgagcaactgggcgttgccgaa gaccaggtgaccaacgaaaaatccttcgtggatgatctgggcgccgattctctggacacg gtcgaactggtcatggcgctggaagacgaattccacatcgagattcccgacgaagacgcc gagaaaatcaccaccgtgcaactggcggttgactacgccaaggcgcactacaaggcctaa

DBGET integrated database retrieval system