Thermophilibacter immobilis: INP52_07020 Help Entry INP52_07020       CDS       T07753                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tio  Thermophilibacter immobilis Pathway tio01100   Metabolic pathways tio01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tio00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     INP52_07020    00074 Mycolic acid biosynthesis     INP52_07020   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     INP52_07020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QOY60165 UniProt:  A0A7S7RU09 LinkDB All DBs Position complement(1558993..1559229) Genome browser AA seq 78 aa AA seqDB search MSHDEILSKVAEFAASAYHYDGGITVQTTFEELGKGSMKMIALTSMIENELDAEVPIREV MTMKTVGELVERVADEME NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcccacgatgagattctttccaaggtcgccgagtttgcggcctccgcctatcactac gacggcggcatcaccgtccagaccaccttcgaggagctcggcaagggctctatgaagatg atcgcgctcacgtcgatgattgagaacgagctcgacgccgaggtccccatccgtgaggtc atgaccatgaagaccgtcggggagctcgtcgagcgcgtcgccgacgagatggagtag

DBGET integrated database retrieval system