Thermincola potens: TherJR_2892 Help Entry TherJR_2892       CDS       T01226                                  Name (GenBank) ATP synthase F0, C subunit   KO K02110   F-type H+-transporting ATPase subunit c Organism tjr  Thermincola potens Pathway tjr00190   Oxidative phosphorylation tjr01100   Metabolic pathways Module tjr_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:tjr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     TherJR_2892  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:tjr00194]     TherJR_2892 Photosynthesis proteins [BR:tjr00194]  Photosystem and electron transport system   F-type ATPase [OT]    TherJR_2892 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  ADG83724 UniProt:  D5XDH8 LinkDB All DBs Position complement(3027452..3027688) Genome browser AA seq 78 aa AA seqDB search MTTVHGLIALGAAFAVGVAAIGAGIGQGIASGKAFESIARQPEVSGTIRTLLFIALAFME TLTIYGLLIAFMLVGKIG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgacaacagttcacggtcttatcgcccttggcgccgcatttgcagtcggtgttgccgct ataggagccggtatcggtcagggtattgcatccggtaaggcttttgaaagtattgcccgt caaccggaagtaagtggtacaattagaacattgctgtttattgccttagcatttatggag accttaactatttacggtctgttaatcgcattcatgttagtaggtaagattggttaa

DBGET integrated database retrieval system