Thermoanaerobacter kivui: TKV_c19290 Help Entry TKV_c19290        CDS       T03397                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism tki  Thermoanaerobacter kivui Pathway tki00020   Citrate cycle (TCA cycle) tki00720   Other carbon fixation pathways tki01100   Metabolic pathways tki01110   Biosynthesis of secondary metabolites tki01120   Microbial metabolism in diverse environments tki01200   Carbon metabolism tki01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:tki00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     TKV_c19290   09102 Energy metabolism    00720 Other carbon fixation pathways     TKV_c19290 Enzymes [BR:tki01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      TKV_c19290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_7 Fer4_2 Fer4_6 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_8 Fer4_15 Fer4_22 Fer4_17 Fer4_13 Fer4_3 Fer4_18 Motif Other DBs NCBI-ProteinID:  AIS53076 UniProt:  A0A097ATD9 LinkDB All DBs Position complement(1859985..1860197) Genome browser AA seq 70 aa AA seqDB search MAKVIFNEDLCKGCELCVNACPKKIIEMDMSKINVKGYHPATVKPENMNKCIGCAFCAMM CPDTVITVIK NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtggcaaaagttatttttaatgaagatttatgtaaaggttgtgaattgtgtgtaaatgct tgtcccaagaaaattattgaaatggacatgagcaaaataaatgtgaagggatatcatcct gccactgttaaaccggaaaatatgaacaaatgtataggttgtgcattttgcgctatgatg tgtcctgatactgttataacagttataaaataa

DBGET integrated database retrieval system