Thioalkalivibrio sp. K90mix: TK90_2153
Help
Entry
TK90_2153 CDS
T01174
Name
(GenBank) ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
tkm
Thioalkalivibrio sp. K90mix
Pathway
tkm03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
tkm00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
TK90_2153
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
tkm03011
]
TK90_2153
Ribosome [BR:
tkm03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
TK90_2153
Bacteria
TK90_2153
Archaea
TK90_2153
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Rpf1_C
PIN_9
Motif
Other DBs
NCBI-ProteinID:
ADC72643
LinkDB
All DBs
Position
complement(2271483..2271833)
Genome browser
AA seq
116 aa
AA seq
DB search
MDKKEARLKRARRARFKIRELGVHRLCIHRTPRHMYAQIIAPSGDAVVAAASTVEKELKS
AGNTGNAEAAARVGQAIAERAKKAGIEQVAFDRAGFRYHGRVKALADAARENGLQF
NT seq
351 nt
NT seq
+upstream
nt +downstream
nt
gtggacaagaaagaggccagacttaagagggcgcgtcgcgcgcggttcaagatccgcgag
ctgggggtgcatcgtctctgtattcaccggacgccccgccacatgtatgcgcagatcatt
gccccttcgggcgacgcggtcgtggctgcggcctccaccgtcgagaaggagctgaagagc
gccggcaacaccgggaacgccgaagcggcggcccgcgtcgggcaggcgatcgccgagcgc
gcaaagaaagccggaatcgaacaggtcgcgttcgaccgtgcgggctttcgttatcacgga
cgggtcaaggccctggccgatgccgcccgtgaaaacggcctgcagttctag
DBGET
integrated database retrieval system