KEGG   Thermococcus kodakarensis: TK0882
Entry
TK0882            CDS       T00226                                 

Name
(GenBank) Agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
tko  Thermococcus kodakarensis
Pathway
tko00330  Arginine and proline metabolism
tko01100  Metabolic pathways
Module
tko_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:tko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    TK0882
Enzymes [BR:tko01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     TK0882
SSDB
Motif
Pfam: Arginase Radical_SAM
Other DBs
NCBI-ProteinID: BAD85071
UniProt: Q5JI38
LinkDB
Position
768484..769350
AA seq 288 aa
MEFLYTYETLKLEFPLVEPEKARFILLGVPFDGTTSYKAGARFGPTLIRQATLNLESYIL
DYDLDIAELPIADIGDIAVVAGDPRKTADRVRETLEELKKANPKAIPILLGGEHSQTLGA
VEALKPASYVVFDAHLDLRNSYEDNPYNHACVARRISELGVKEAIFGIRSGTKEEVDFAR
ERDIPWVHARDYSFDAFVDLVEALPEPVYLSIDIDVFDLSMVPSTGTPEAGGLRFWEVVE
AIEWLVEKKEIAGFDIMEVAGEKLGDPTALTAAKLLFYSIGAMAKFGR
NT seq 867 nt   +upstreamnt  +downstreamnt
atggagttcctgtacacgtatgagactctcaagctggagttcccgctcgtagaacccgag
aaagccaggttcatcctgctgggggttcccttcgacgggactacgagctacaaagctggg
gcacgcttcgggccgaccctaataaggcaggcgactctgaaccttgagagctacatccta
gactacgaccttgacatagcggagctcccaatagccgacatcggagacattgccgtcgtc
gcaggagacccgaggaaaacggcagacagggtaagggaaacccttgaagagctcaagaag
gcaaacccaaaggctattccaatcctcctaggcggagaacattcccagacgcttggagca
gttgaagcactgaagccagcaagctacgtcgtcttcgacgcccacctcgacctgcgcaac
agctacgaagacaacccctacaaccatgcctgcgtcgcgaggcggatcagcgagctaggg
gtaaaggaagcgatattcggaatcaggagtggcaccaaagaggaagtcgattttgcaagg
gagagggatatcccgtgggtgcacgcgagggactacagctttgacgccttcgttgacctc
gtagaggcccttcccgaaccggtttacctctcaatcgacatcgacgtctttgacctctct
atggtgccctcaacgggcactcctgaggcgggaggtttaaggttctgggaggtagtggag
gcaatagaatggctggtcgagaagaaggagatagcgggctttgacataatggaggttgca
ggtgaaaagctcggcgatccgacggcattgacggctgcaaagctcctcttctactccatt
ggtgcaatggcaaaattcgggcgctga

DBGET integrated database retrieval system