Thiothrix lacustris: RCF98_03250 Help Entry RCF98_03250       CDS       T09396                                  Symbol queF Name (GenBank) preQ(1) synthase   KO K09457   7-cyano-7-deazaguanine reductase [EC:1.7.1.13] Organism tlc  Thiothrix lacustris Pathway tlc00790   Folate biosynthesis tlc01100   Metabolic pathways Module tlc_M00988   PreQ1 biosynthesis, GTP => 7-Aminomethyl-7-deazaguanine Brite KEGG Orthology (KO) [BR:tlc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     RCF98_03250 (queF)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:tlc03016]     RCF98_03250 (queF) Enzymes [BR:tlc01000]  1. Oxidoreductases   1.7  Acting on other nitrogenous compounds as donors    1.7.1  With NAD+ or NADP+ as acceptor     1.7.1.13  preQ1 synthase      RCF98_03250 (queF) Transfer RNA biogenesis [BR:tlc03016]  Prokaryotic type   tRNA modification factors    Other tRNA modification factors     RCF98_03250 (queF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  QueF QueF_N BioW Motif Other DBs NCBI-ProteinID:  WML91376 UniProt:  A0ABY9MRU9 LinkDB All DBs Position complement(693769..694158) Genome browser AA seq 129 aa AA seqDB search MSTRPSKELETFPNPNPQRDYTIRIDLPEFTCICPKTGQPDFAQFKIEYVADEKCVELKS LKLYMWSYREEGAFHEAVTNKILEDLVSATDPRFMRLTGVWNVRGGVYTTVIVEHRKAGW QPAPKVELP NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtccacacgccccagcaaagaacttgaaaccttcccgaaccctaatccgcaacgtgat tacactatccgtatcgacttaccggaatttacctgcatttgcccaaaaactgggcagccg gatttcgcgcagttcaaaattgaatacgtggcggatgagaagtgtgtggagttgaaatcc ctcaagctttatatgtggagttaccgcgaagagggggctttccacgaagctgtcaccaac aagattctggaagatctggtgtcagcaaccgacccacgttttatgcgcctgaccggggtg tggaatgtgcgtggtggggtgtacactaccgttatcgtcgagcaccgcaaagctggctgg cagcctgcccctaaggttgaactgccgtaa

DBGET integrated database retrieval system