Thiothrix lacustris: RCF98_17515 Help Entry RCF98_17515       CDS       T09396                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tlc  Thiothrix lacustris Pathway tlc01100   Metabolic pathways tlc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tlc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RCF98_17515 (acpP)    00074 Mycolic acid biosynthesis     RCF98_17515 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RCF98_17515 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WML90748 LinkDB All DBs Position complement(3610452..3610688) Genome browser AA seq 78 aa AA seqDB search MSDIEERVKKIVVEQLGVDEAEVTYLSSFIDDLGADSLDTVELVMALEEEFGAEIPDEDA EKITTVQAAIDYIKAQQG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatagaagaacgcgtcaagaaaatcgttgttgaacaactgggtgttgatgaa gctgaggtcacctatctttcttctttcattgacgatctcggcgcggattctctggatacc gtcgaactggttatggcactggaagaagaattcggtgctgagatccctgatgaagatgca gaaaagatcacaacggtccaagctgctattgattacatcaaggctcagcagggttaa

DBGET integrated database retrieval system