Temnothorax longispinosus: 139825312 Help Entry 139825312         CDS       T10889                                  Name (RefSeq) uncharacterized protein   KO K10740   replication factor A3 Organism tln  Temnothorax longispinosus Pathway tln03030   DNA replication tln03420   Nucleotide excision repair tln03430   Mismatch repair tln03440   Homologous recombination tln03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:tln00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     139825312    03420 Nucleotide excision repair     139825312    03430 Mismatch repair     139825312    03440 Homologous recombination     139825312    03460 Fanconi anemia pathway     139825312  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tln03032]     139825312    03400 DNA repair and recombination proteins [BR:tln03400]     139825312 DNA replication proteins [BR:tln03032]  Eukaryotic type   DNA Replication Elongation Factors    RPA (replication protein A)     139825312 DNA repair and recombination proteins [BR:tln03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     RPA (replication factor A)      139825312    MMR (mismatch excision repair)      139825312   DSBR (double strand breaks repair)    HR (homologous recombination)      139825312 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rep_fac-A_3 Motif Other DBs NCBI-GeneID:  139825312 NCBI-ProteinID:  XP_071654053 LinkDB All DBs Position 2:complement(1364215..1365739) Genome browser AA seq 117 aa AA seqDB search MSDTRVLGKRLGQRVNQEAIVLGRITEKSSEGKSAEITTTDDARVNVTFLEPLTRASNLS DYVEVHGTVKSKSTMSCSRVIYFPPDMSKDFDTNSYNTMMNMRCAVEKELEGGFYGD NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgtcagacacacgtgttctgggcaagcgattagggcaacgcgtcaatcaagaggcgatc gtgcttggcagaatcacggagaaaagctcggaaggtaagagcgcagaaataacaacaacg gatgacgctcgagttaacgtcacgtttctcgagccactcactcgagccagcaacctttca gactacgtagaggtgcacggtacagtgaagtccaagtctaccatgtcctgcagtagagtt atatacttcccaccggacatgagtaaagactttgatacaaacagctacaacacaatgatg aatatgcgctgcgcagtggaaaaggagttagagggagggttttacggagattaa

DBGET integrated database retrieval system