Thiorhodovibrio litoralis: Thiosp_02773 Help Entry Thiosp_02773      CDS       T09560                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism tlr  Thiorhodovibrio litoralis Pathway tlr00190   Oxidative phosphorylation tlr01100   Metabolic pathways tlr02020   Two-component system Module tlr_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:tlr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Thiosp_02773  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Thiosp_02773 Enzymes [BR:tlr01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Thiosp_02773 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  WPL12988 LinkDB All DBs Position 3080562..3080675 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGVLLAIAFGIINVMWYESEQCLSPANDDT NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcctggatacttggcgtcctgctggccatcgccttcggtatcatcaat gtcatgtggtatgagtctgagcaatgcctcagcccagccaatgacgatacctga

DBGET integrated database retrieval system