Thermococcus litoralis: OCC_04178 Help Entry OCC_04178         CDS       T02800                                  Name (GenBank) histone   KO K24450   DNA-binding protein Organism tlt  Thermococcus litoralis Brite KEGG Orthology (KO) [BR:tlt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tlt03036]     OCC_04178 Chromosome and associated proteins [BR:tlt03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     OCC_04178 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C CENP-S TFIID-31kDa Bromo_TP TAF TFIID-18kDa TFIID_20kDa DUF1931 LonB_AAA-LID CENP-X DUF4923 Motif Other DBs NCBI-ProteinID:  EHR78220 UniProt:  H3ZPI5 LinkDB All DBs Position complement(1599284..1599487) Genome browser AA seq 67 aa AA seqDB search MAELPIAPIDRLIRKAGAERVSEEAAKILAEYLEEYAVELGKKAVEFARHAGRKTVKAED IKLAIKA NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggctgagttgccaattgccccaattgacagattgattagaaaggctggtgccgagaga gttagtgaagaggccgccaagatactcgccgagtacctcgaagaatacgcagtcgagctc ggaaagaaggctgttgaattcgctagacacgccggcagaaagacagtcaaagccgaggac attaagcttgcaatcaaggcttga

DBGET integrated database retrieval system