Thermococcus litoralis: OCC_08764 Help Entry OCC_08764         CDS       T02800                                  Name (GenBank) cobalt transporter   KO K02009   cobalt/nickel transport protein Organism tlt  Thermococcus litoralis Pathway tlt02010   ABC transporters Brite KEGG Orthology (KO) [BR:tlt00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     OCC_08764  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:tlt02000]     OCC_08764 Transporters [BR:tlt02000]  ABC transporters, prokaryotic type   Metallic cation, iron-siderophore and vitamin B12 transporters    Cobalt transporter     OCC_08764    Nickel transporter     OCC_08764 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PDGLE Motif Other DBs NCBI-ProteinID:  EHR79632 UniProt:  H3ZK79 LinkDB All DBs Position complement(1800435..1800683) Genome browser AA seq 82 aa AA seqDB search MRNIVKGLLIILILLAIALPFASENPDGLEATMEKVHLEESPVYSAPLDYGETWGQSLIM GAIGITLVFGIAYGLGKLIKGV NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagaaacatcgtaaaaggattgctcataatccttatcctgctcgcaattgccttgcca tttgcatctgaaaacccagatgggcttgaagcaacaatggaaaaagtacatctggaggaa tctccagtttacagcgctcctctcgactacggcgaaacgtggggacaaagtcttataatg ggagcaattgggataacacttgtctttggaatagcttacggacttggaaaactgataaaa ggtgtctga

DBGET integrated database retrieval system