Thalassospira lucentensis: R1T41_02410 Help Entry R1T41_02410       CDS       T09476                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism tlu  Thalassospira lucentensis Brite KEGG Orthology (KO) [BR:tlu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tlu03110]     R1T41_02410 (grxC) Chaperones and folding catalysts [BR:tlu03110]  Protein folding catalysts   Protein disulfide isomerase    R1T41_02410 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Thioredoxin_3 SH3BGR Glrx-like CLIC-like_N GST_N Thioredoxin_2 Thioredoxin_9 Thioredoxin Motif Other DBs NCBI-ProteinID:  WOI11443 LinkDB All DBs Position complement(372533..372790) Genome browser AA seq 85 aa AA seqDB search MAKVEVYATEWCPYCKRARKLLEEKGAKYELIDVMMEPRRKKEMMDRASGRHTVPQIFIN DEHIGGCDELMALNAKGGLDSKLSA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcaaaagtcgaagtttacgccaccgaatggtgcccctattgcaagcgtgcccgcaag cttctggaagaaaagggtgccaaatacgaactgattgatgtgatgatggaaccgcgtcgc aaaaaggaaatgatggatcgtgcgagtggccgtcataccgtgccgcagattttcatcaat gacgaacatatcggcggctgcgacgaacttatggcgctgaacgccaagggcggtctggac agcaagctgtcggcataa

DBGET integrated database retrieval system