KEGG   Thalassospira lucentensis: R1T41_19985
Entry
R1T41_19985       CDS       T09476                                 
Name
(GenBank) oxidoreductase
Organism
tlu  Thalassospira lucentensis
Pathway
tlu00600  Sphingolipid metabolism
tlu04382  Cornified envelope formation
Brite
KEGG Orthology (KO) [BR:tlu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    R1T41_19985
 09150 Organismal Systems
  09158 Development and regeneration
   04382 Cornified envelope formation
    R1T41_19985
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_10 Eno-Rase_NADH_b NSRP1_N RmlD_sub_bind
Other DBs
NCBI-ProteinID: WOI10776
LinkDB
Position
4136286..4137134
AA seq 282 aa
MTTNTNSKNILITGVSSGFGRAFATAAIAEGHHVIGTVRKQADLAAFTALSPAQTTGIIL
DVTDFDAIPGAIRQIETDIGPIDVLINNAGYGHEGLLEESPLAELEAQFRVNVFGAVAMI
KAVLPHMRQRRRGHILNVTSMGGFITMPGISYYCGSKFALEGISETLASEVAGLGIHVTA
IEPGSFRTDWAGRSMVRSDRSISDYDTLFDPIRDARQKKSGNQAGDPAKAAKAVMDILNV
PNPPVHLLLGRDALGLVREKLDHLGREIATWEHLSTSTDYDA
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaccacgaatacaaattcgaaaaacatcctgatcaccggcgtcagttccggcttcggc
cgcgcctttgccacggcggcaattgccgaaggccaccatgtcatcggcacggtccgcaaa
caggccgaccttgccgccttcaccgccctgtccccggcacagaccaccggcatcatcctt
gatgtcacggattttgacgccatccccggcgcgatcaggcagatcgaaaccgatatcggc
ccgattgacgttctgatcaacaatgccggatatggtcacgaaggattgcttgaagaatcc
ccgcttgccgaactcgaagcccaattccgggtcaatgtgtttggcgcggtcgcgatgatc
aaggccgtcctgccccatatgcgccaacgcagacgcggccatatcctcaatgtcacctcg
atgggcggcttcatcaccatgcccggcatttcctactattgcggcagcaagttcgccctc
gaaggcatcagcgaaacactggccagcgaagtcgccgggctgggcattcacgtcaccgcg
attgagccgggatcattccgcaccgactgggccgggcgttccatggtccgctccgaccgc
agtatttccgattatgacaccctgtttgatccgatccgcgatgcccgccagaaaaaaagc
ggcaatcaggccggtgatcctgccaaggccgcaaaggcggtgatggatatcctgaatgtg
cccaacccgccggttcaccttttgctggggcgcgatgcgctgggtctggtgcgtgaaaag
cttgatcaccttgggcgcgaaatagccacttgggaacatctcagcacatcaaccgattac
gacgcctga

DBGET integrated database retrieval system