Thalassospira lucentensis: R1T41_21240 Help Entry R1T41_21240       CDS       T09476                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tlu  Thalassospira lucentensis Pathway tlu01100   Metabolic pathways tlu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tlu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     R1T41_21240    00074 Mycolic acid biosynthesis     R1T41_21240   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     R1T41_21240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WOI11012 LinkDB All DBs Position complement(4413486..4413722) Genome browser AA seq 78 aa AA seqDB search MSDVADRVKKIVVEHLGVEEDKVTENASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA EKILTVKDAIDFIEKANG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatgtcgcagatcgcgtgaagaagatcgttgtcgagcacctcggtgtcgaggaa gacaaggtcaccgaaaacgcaagcttcatcgacgatctgggcgccgacagcctggacact gtcgagctggtcatggcgtttgaagaagaattcggttgcgaaattcctgatgacgcagca gaaaaaattctgaccgttaaagacgcgatcgacttcatcgaaaaggcgaacggctaa

DBGET integrated database retrieval system