Thermotoga maritima MSB8: TM0249 Help Entry TM0249            CDS       T00022                                  Name (GenBank) rnfB-related protein   KO K03616   H+/Na+-translocating ferredoxin:NAD+ oxidoreductase subunit B [EC:7.1.1.11 7.2.1.2] Organism tma  Thermotoga maritima MSB8 Brite KEGG Orthology (KO) [BR:tma00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     TM0249 Enzymes [BR:tma01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.11  ferredoxin---NAD+ oxidoreductase (H+-transporting)      TM0249   7.2  Catalysing the translocation of inorganic cations    7.2.1  Linked to oxidoreductase reactions     7.2.1.2  ferredoxin---NAD+ oxidoreductase (Na+-transporting)      TM0249 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FeS Motif Other DBs NCBI-ProteinID:  AAD35340 UniProt:  Q9WY91 LinkDB All DBs Position 262673..262975 Genome browser AA seq 100 aa AA seqDB search MKELEVIYSTLLLAVLGFGFGAFLAYSAQRFKVEEDPRVKMITEVLPGINCGACGFAGCE AYAKAIVKGQAETNRCLPGRPQGVEEKIKKILEEYKNVSS NT seq 303 nt NT seq  +upstreamnt  +downstreamnt gtgaaggagttggaagtcatctactcgacgctcttgctcgctgttctgggttttgggttc ggggcttttcttgcctattctgcgcaaagattcaaggtggaagaagatccacgtgtgaag atgataacggaggttcttcctggaataaactgtggcgcgtgcggttttgccgggtgtgaa gcctacgcgaaggcgatcgtgaagggtcaggcggaaacgaacaggtgtctccccggaaga cctcagggtgtcgaagagaagataaagaagattctcgaggagtacaagaatgtctcctct tga

DBGET integrated database retrieval system