Thermotoga maritima MSB8: TM0879 Help Entry TM0879            CDS       T00022                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism tma  Thermotoga maritima MSB8 Pathway tma00020   Citrate cycle (TCA cycle) tma00720   Other carbon fixation pathways tma01100   Metabolic pathways tma01110   Biosynthesis of secondary metabolites tma01120   Microbial metabolism in diverse environments tma01200   Carbon metabolism tma01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:tma00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     TM0879   09102 Energy metabolism    00720 Other carbon fixation pathways     TM0879 Enzymes [BR:tma01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      TM0879 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_7 Fer4_21 Fer4_10 Fer4_9 Fer4_16 LdpA_Fe-S-bd Fer4_4 Fer4_13 Fer4_3 Fer4_17 Fer4_8 Fer4_15 Fer4_22 Motif Other DBs NCBI-ProteinID:  AAD35960 UniProt:  Q9WZY1 LinkDB All DBs Position complement(902035..902232) Genome browser AA seq 65 aa AA seqDB search MGYKIVVNYDWCKACKLCAWACPTSAITSDEIGKPVTNENKCIGCLKCEKICPDMAIEIV SDENA NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgggttacaagatcgtggtgaattacgactggtgcaaagcgtgtaagctgtgcgcgtgg gcttgtccgactagtgccattacaagcgatgaaataggaaaacccgtgacaaacgaaaac aaatgcatcggatgtttaaaatgtgagaaaatatgtccggatatggccatagaaattgtg agtgatgagaatgcctga

DBGET integrated database retrieval system