Thioflavicoccus mobilis: Thimo_1166 Help Entry Thimo_1166        CDS       T02397                                  Name (GenBank) ATP synthase, F0 subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism tmb  Thioflavicoccus mobilis Pathway tmb00190   Oxidative phosphorylation tmb01100   Metabolic pathways Module tmb_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:tmb00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Thimo_1166  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:tmb00194]     Thimo_1166 Photosynthesis proteins [BR:tmb00194]  Photosystem and electron transport system   F-type ATPase [OT]    Thimo_1166 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AGA89966 UniProt:  L0GVH9 LinkDB All DBs Position 1267135..1267368 Genome browser AA seq 77 aa AA seqDB search MELAQAIQFIAAGLMLGLGALGAAVGIGVLGGRFLEGAARQPELIPMLRTQFFIVMGLTD ALPVISIAMGLYLMFAV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggaactcgcacaagctattcagttcatcgcggctggtctgatgctgggtctgggcgcc ctgggcgcggcggtcggcatcggcgtcctcggcgggcgcttcctcgagggcgcggcgcgc cagcccgagctgatcccgatgctgcgtacccaattcttcatcgtgatgggcctgaccgac gccctgccggtcatctcgatcgcgatgggtctctatttgatgttcgctgtctaa

DBGET integrated database retrieval system