KEGG   Thioflavicoccus mobilis: Thimo_2321
Entry
Thimo_2321        CDS       T02397                                 
Name
(GenBank) putative permease
  KO
K11720  lipopolysaccharide export system permease protein
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tmb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Thimo_2321
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tmb02000]
    Thimo_2321
Transporters [BR:tmb02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    Thimo_2321
SSDB
Motif
Pfam: LptF_LptG
Other DBs
NCBI-ProteinID: AGA91061
UniProt: L0GYN3
LinkDB
Position
2577406..2578470
AA seq 354 aa
MRILDRYIASSVISGTLIALAALLPLLGFFLMADEVDQIGEHDYQFVDALIYVTLSMPRY
AYEIFPIATLIGAVAGLGALASGSELVAMRAAGISIGRLVLAALKGGMPLVLAAILIGEG
LAPYAQQQAQQGRSEALTGQVMQHTDSGFWARDGDTFVNIREILSGSNLRDISIYEIGPR
QRLTLASHAEEARYADGQWTLESIVRSHISLSGVQVERIGHARWDSLLNPRLLEVIVIEP
EALPVWDLYHYVRFMANTDQDGRRYEVVLWSKLVHPALILTMIFVAIPILLGSTRTKSMG
TQIVLAILVGIVLYLLSRTLVYLSLLFDLSPMIAATLPPLFFLAAALWLLRRVG
NT seq 1065 nt   +upstreamnt  +downstreamnt
ttgcgcatcctggatcgttacattgccagctcggtgatcagcggcaccctgatcgccctc
gccgcgctcctgccgctgctcggtttcttcttgatggccgacgaggtggaccagatcggc
gagcacgactaccagttcgtcgacgccttgatctacgtcacgctgagcatgccccgctac
gcctacgaaatcttcccgatcgccaccctgatcggtgccgtggccggattgggggcgctc
gccagcggctcagaactggtcgcgatgcgcgccgccggcatatcgatcggacgcctcgtg
ctcgcggccctgaagggcggcatgcccttggtgctggccgcgattctcatcggcgagggt
ctcgcaccctacgcccagcagcaggctcaacagggacgctccgaggcattgaccggacaa
gtcatgcagcacaccgacagcggcttctgggcacgcgacggcgacaccttcgtcaacatc
cgcgagatcctctcgggcagcaacctgcgcgatatctcgatctacgagatcggccctcgc
caaagactgacgttggcctcccatgccgaggaggcacgctatgccgacggccaatggaca
ctggaatcgatcgtccgcagccacatctcgctgagcggggtccaggtcgaacggatcggt
catgcccgctgggattcgctgctcaacccgcggctgctggaagtcatcgtcatcgaaccc
gaggccctgccggtctgggacctctaccactatgtgcgcttcatggccaatacggaccag
gacgggcgccgctacgaggtcgtcctctggagcaagctcgtccacccggcgctgatcctg
acgatgatcttcgtcgccatccccatcctgctcggatcgacgcgcaccaagagcatgggc
acgcagatcgtcctggcgatcttggtcggcatcgtcttatatctactcagccggaccctg
gtttatctgtcgctgttgttcgatctgagcccgatgatcgccgcgacgctcccgccgctg
ttcttcctcgcggccgcgctctggttgctgcgacgcgtcggctga

DBGET integrated database retrieval system