Thioflavicoccus mobilis: Thimo_2379 Help Entry Thimo_2379        CDS       T02397                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tmb  Thioflavicoccus mobilis Pathway tmb00998   Biosynthesis of various antibiotics tmb01100   Metabolic pathways tmb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tmb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Thimo_2379    00074 Mycolic acid biosynthesis     Thimo_2379   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Thimo_2379 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AGA91115 UniProt:  L0H0F4 LinkDB All DBs Position complement(2639574..2639810) Genome browser AA seq 78 aa AA seqDB search MSSVEERVRKIVVEQLGAKEEDVTPEASFVDDLGADSLDTVELVMALEEEFETEIPDEDA EKITTVQQAIDYVNAHLG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagcgttgaagagcgagttcgcaagatcgtcgtggagcagttgggagcgaaggag gaggatgtgacgccagaagcctccttcgtcgacgatctcggtgccgattccctggataca gtcgagctggtgatggcgctcgaagaggagttcgaaaccgaaatcccggatgaagacgcc gagaaaatcaccactgtccagcaggccatcgactacgtcaacgcccatctcggttga

DBGET integrated database retrieval system