Legionella micdadei: LMI_2390 Help Entry LMI_2390          CDS       T03810                                  Symbol groS Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism tmc  Legionella micdadei Brite KEGG Orthology (KO) [BR:tmc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tmc03110]     LMI_2390 (groS)    03029 Mitochondrial biogenesis [BR:tmc03029]     LMI_2390 (groS) Chaperones and folding catalysts [BR:tmc03110]  Heat shock proteins   HSP10    LMI_2390 (groS) Mitochondrial biogenesis [BR:tmc03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     LMI_2390 (groS) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 Beta-barrel_SelB Motif Other DBs NCBI-ProteinID:  CEG61658 UniProt:  A0A098GGP7 LinkDB All DBs Position I:complement(2486813..2487103) Genome browser AA seq 96 aa AA seqDB search MKIRPLHDRVVVRRMEEERTTAGGIVIPDSATEKPMRGEIIAVGPGKVLENGDVRALAVK VGDVVLFGKYSGTEVKISGQELVVMREDDIMGVIEK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaaaattcgtcctttacacgatcgtgttgttgttcgtcgtatggaagaagagcgtacc acagccggtggtattgttattccagacagcgctactgaaaagccaatgcgtggggaaatc atcgcagtgggtcctggcaaagttttggagaacggtgatgttcgtgctttggctgttaaa gtaggtgatgtggttctgtttggtaagtactcaggtacagaagtcaagatatcaggccaa gaactggtagtgatgcgcgaagacgatatcatgggcgtgattgagaagtaa

DBGET integrated database retrieval system