Thalassovita mediterranea: KUV46_14715 Help Entry KUV46_14715       CDS       T07443                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tmd  Thalassovita mediterranea Pathway tmd01100   Metabolic pathways tmd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tmd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KUV46_14715    00074 Mycolic acid biosynthesis     KUV46_14715   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KUV46_14715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  QYJ00570 LinkDB All DBs Position complement(3006575..3006811) Genome browser AA seq 78 aa AA seqDB search MSDVFERVKKIVVENLDVEADKVTESASFIDDLGADSLDLVELVMAFEEEFNIEIPDDVQ ENIRTVGDAVTHIKAHVS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgacgttttcgagcgtgtaaaaaagatcgttgtcgagaatctcgacgttgaagca gacaaggtcacggaatcggcgagcttcatcgacgatctcggcgctgactccctcgacctg gtcgagctggtcatggctttcgaagaagagttcaacatcgaaatccctgacgacgttcaa gagaacatccgtaccgttggtgacgctgtcacccacatcaaggctcacgtctcttaa

DBGET integrated database retrieval system