Talaromyces marneffei: EYB26_005417 Help Entry EYB26_005417      CDS       T06392                                  Name (RefSeq) uncharacterized protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism tmf  Talaromyces marneffei Pathway tmf03020   RNA polymerase tmf03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tmf00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     EYB26_005417   09124 Replication and repair    03420 Nucleotide excision repair     EYB26_005417  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tmf03021]     EYB26_005417    03400 DNA repair and recombination proteins [BR:tmf03400]     EYB26_005417 Transcription machinery [BR:tmf03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      EYB26_005417   RNA polymerase III system    RNA polymerase III      EYB26_005417   RNA polymerase I system    RNA polymerase I      EYB26_005417 DNA repair and recombination proteins [BR:tmf03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       EYB26_005417 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_RNApol_7kD zinc_ribbon_4 DZR_2 TackOD1 YjdM_Zn_Ribbon DZR HypA Motif Other DBs NCBI-GeneID:  79165390 NCBI-ProteinID:  XP_054120677 LinkDB All DBs Position 4:join(985162..985385,985449..985473) Genome browser AA seq 82 aa AA seqDB search MSREAYQVPALDNQTAFGNGGGAGAGGAGGYTQPQVQSSRYICGECDAKFSLPPNATLRC TECGHRILYKERTKRIVQFEAR NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtcccgcgaagcctaccaagtccccgccctcgacaatcaaaccgcctttggcaatggt ggcggcgccggcgctggtggtgcaggtggttatacgcaaccccaagtccagtcctcacga tacatctgcggtgaatgcgatgcaaagttttcgttgcctcctaatgcgacgttgaggtgt acggagtgcggacatcggatattgtataaggagcgcacgaagagaattgtccagtttgag gcacgataa

DBGET integrated database retrieval system