Thiomicrospira microaerophila: JX580_02475 Help Entry JX580_02475       CDS       T08259                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tmh  Thiomicrospira microaerophila Pathway tmh01100   Metabolic pathways tmh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tmh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JX580_02475 (acpP)    00074 Mycolic acid biosynthesis     JX580_02475 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JX580_02475 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  UQB42781 LinkDB All DBs Position 513954..514190 Genome browser AA seq 78 aa AA seqDB search MSSIEDRVKKIVVEQLGVEEAQVTPDASFIDDLGADSLDTVELVMALEEEFDCEIPDEEA EKISTLAQAVSYINANLE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagtattgaagatcgcgttaagaaaatcgttgttgagcaattaggcgttgaagaa gcacaggttacacctgatgcgtcttttattgacgatttaggtgccgattctcttgacacc gtagaattggtaatggcattggaagaagagtttgattgtgaaatcccagacgaagaagct gaaaaaatttcaactttagcgcaagcggtttcatatatcaatgcaaacttggaataa

DBGET integrated database retrieval system