Thiomicrospira microaerophila: JX580_06925 Help Entry JX580_06925       CDS       T08259                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism tmh  Thiomicrospira microaerophila Brite KEGG Orthology (KO) [BR:tmh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tmh03032]     JX580_06925    03036 Chromosome and associated proteins [BR:tmh03036]     JX580_06925    03400 DNA repair and recombination proteins [BR:tmh03400]     JX580_06925 DNA replication proteins [BR:tmh03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     JX580_06925 Chromosome and associated proteins [BR:tmh03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     JX580_06925 DNA repair and recombination proteins [BR:tmh03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       JX580_06925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  UQB41421 LinkDB All DBs Position complement(1407333..1407605) Genome browser AA seq 90 aa AA seqDB search MNKSELVSAIAEKAGLTKVQAASALDATVASVTAALAKGDQVAIIGFGTFKVGERAARTG RNPQTGAEMQIPAAKVPKFAAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaatctgaattagtaagcgcgattgcagaaaaagctggcttaacaaaagtacaa gctgctagtgcgttagatgcgacggttgcaagtgttacagctgctttagctaagggtgac caggttgcgatcatcggtttcggtacctttaaagttggtgaacgcgctgcacgtacagga cgcaatccacaaactggcgctgaaatgcagattccagcggccaaagtaccgaaatttgct gctggtaaggctcttaaggatgcggttaactaa

DBGET integrated database retrieval system