Thermotoga maritima MSB8: THEMA_00240 Help Entry THEMA_00240       CDS       T02976                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism tmi  Thermotoga maritima MSB8 Pathway tmi00020   Citrate cycle (TCA cycle) tmi00720   Other carbon fixation pathways tmi01100   Metabolic pathways tmi01110   Biosynthesis of secondary metabolites tmi01120   Microbial metabolism in diverse environments tmi01200   Carbon metabolism tmi01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:tmi00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     THEMA_00240   09102 Energy metabolism    00720 Other carbon fixation pathways     THEMA_00240 Enzymes [BR:tmi01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      THEMA_00240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_7 Fer4_21 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_13 Fer4_3 Fer4_17 Fer4_8 Fer4_15 Fer4_22 Motif Other DBs NCBI-ProteinID:  AHD17368 UniProt:  Q9WZY1 LinkDB All DBs Position 43376..43573 Genome browser AA seq 65 aa AA seqDB search MGYKIVVNYDWCKACKLCAWACPTSAITSDEIGKPVTNENKCIGCLKCEKICPDMAIEIV SDENA NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgggttacaagatcgtggtgaattacgactggtgcaaagcgtgtaagctgtgcgcgtgg gcttgtccgactagtgccattacaagcgatgaaataggaaaacccgtgacaaacgaaaac aaatgcatcggatgtttaaaatgtgagaaaatatgtccggatatggccatagaaattgtg agtgatgagaatgcctga

DBGET integrated database retrieval system