Telluria mixta: P0M04_07955 Help Entry P0M04_07955       CDS       T08884                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism tmj  Telluria mixta Brite KEGG Orthology (KO) [BR:tmj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tmj03110]     P0M04_07955 (grxC) Chaperones and folding catalysts [BR:tmj03110]  Protein folding catalysts   Protein disulfide isomerase    P0M04_07955 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like GST_N_2 Thioredoxin_2 Thioredoxin_4 Motif Other DBs NCBI-ProteinID:  WEM97642 LinkDB All DBs Position 1801209..1801478 Genome browser AA seq 89 aa AA seqDB search MTAHVVLYHTASCPYCVRAERLLEAKGVTDIERIRVDLDPEQRAIMMQRTGRRTVPQIYV GDTHVGGFDDLYALDQAGRLDPLLKGAAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgacagcccatgttgtcctctatcacaccgcaagctgcccctactgcgtgcgcgccgag cgcctgctggaagccaagggcgtgaccgacatcgaacgcatccgcgtcgacctcgatccg gaacagcgcgccatcatgatgcagcgcacgggccgccgcacggtgccgcagatctacgtg ggcgacacccacgtgggcggattcgacgacctgtacgcactcgaccaggcgggccgcctg gatccgctgctgaagggcgcagcagcctga

DBGET integrated database retrieval system