Telluria mixta: P0M04_18165
Help
Entry
P0M04_18165 CDS
T08884
Name
(GenBank) NADH-quinone oxidoreductase subunit J
KO
K00339
NADH-quinone oxidoreductase subunit J [EC:
7.1.1.2
]
Organism
tmj
Telluria mixta
Pathway
tmj00190
Oxidative phosphorylation
tmj01100
Metabolic pathways
Module
tmj_M00144
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:
tmj00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
P0M04_18165
Enzymes [BR:
tmj01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
P0M04_18165
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Oxidored_q3
DUF6057
DUF1774
Motif
Other DBs
NCBI-ProteinID:
WEM93432
LinkDB
All DBs
Position
4071061..4071726
Genome browser
AA seq
221 aa
AA seq
DB search
MDFTTVLFYVFSAVMVLAGLRVITAKNPVHAALFLVLAFFNAAGIWMLLKAEFLAIVLVL
VYVGAVMVLFLFVVMMLDINIDRMREGFWGYLPVASGVGALIVLEMAAVLWRGFLGQGDA
PAEATVGHIGGTHELGRLIYTQYIYGFEIAGLILLVAIIAAVALTLRKRKDTKAIDPGLA
VRVKRNDRLKIVKMQTVNQKAIDDAAIAAAAAAAAANKEAQ
NT seq
666 nt
NT seq
+upstream
nt +downstream
nt
atggatttcacaactgttctgttctacgtcttctcggccgtgatggtgctggccgggttg
cgcgtcattaccgccaagaacccggtccacgccgcgctgttcctggtgctcgcgttcttc
aacgctgccggtatctggatgctgctcaaggccgagttcctggccatcgtgctggtactg
gtctacgtcggcgccgtcatggtgctgttcctgttcgtcgtgatgatgctcgacattaac
atcgaccgcatgcgcgaaggcttctggggctacctgccggtggcgtcgggcgtcggcgcg
ctgatcgtgctggagatggccgccgtgctgtggcgcggcttcctgggccagggcgatgcg
ccggccgaggcgaccgtgggtcacatcggcggcacgcatgaactgggccgcctgatctac
acccagtacatctacggtttcgagatcgccggcctgatcctgctggtcgccatcatcgcc
gccgtggcgctgaccctgcgcaagcgcaaggacaccaaagccatcgacccgggcctcgcc
gtccgcgtcaagcgtaacgaccgtctgaagatcgtcaagatgcagacggtgaaccagaag
gcgatcgacgatgcggcaatcgctgccgcagctgctgccgccgctgccaacaaggaggcg
caatga
DBGET
integrated database retrieval system