KEGG   Telluria mixta: P0M04_18165
Entry
P0M04_18165       CDS       T08884                                 
Name
(GenBank) NADH-quinone oxidoreductase subunit J
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
tmj  Telluria mixta
Pathway
tmj00190  Oxidative phosphorylation
tmj01100  Metabolic pathways
Module
tmj_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tmj00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    P0M04_18165
Enzymes [BR:tmj01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     P0M04_18165
SSDB
Motif
Pfam: Oxidored_q3 DUF6057 DUF1774
Other DBs
NCBI-ProteinID: WEM93432
LinkDB
Position
4071061..4071726
AA seq 221 aa
MDFTTVLFYVFSAVMVLAGLRVITAKNPVHAALFLVLAFFNAAGIWMLLKAEFLAIVLVL
VYVGAVMVLFLFVVMMLDINIDRMREGFWGYLPVASGVGALIVLEMAAVLWRGFLGQGDA
PAEATVGHIGGTHELGRLIYTQYIYGFEIAGLILLVAIIAAVALTLRKRKDTKAIDPGLA
VRVKRNDRLKIVKMQTVNQKAIDDAAIAAAAAAAAANKEAQ
NT seq 666 nt   +upstreamnt  +downstreamnt
atggatttcacaactgttctgttctacgtcttctcggccgtgatggtgctggccgggttg
cgcgtcattaccgccaagaacccggtccacgccgcgctgttcctggtgctcgcgttcttc
aacgctgccggtatctggatgctgctcaaggccgagttcctggccatcgtgctggtactg
gtctacgtcggcgccgtcatggtgctgttcctgttcgtcgtgatgatgctcgacattaac
atcgaccgcatgcgcgaaggcttctggggctacctgccggtggcgtcgggcgtcggcgcg
ctgatcgtgctggagatggccgccgtgctgtggcgcggcttcctgggccagggcgatgcg
ccggccgaggcgaccgtgggtcacatcggcggcacgcatgaactgggccgcctgatctac
acccagtacatctacggtttcgagatcgccggcctgatcctgctggtcgccatcatcgcc
gccgtggcgctgaccctgcgcaagcgcaaggacaccaaagccatcgacccgggcctcgcc
gtccgcgtcaagcgtaacgaccgtctgaagatcgtcaagatgcagacggtgaaccagaag
gcgatcgacgatgcggcaatcgctgccgcagctgctgccgccgctgccaacaaggaggcg
caatga

DBGET integrated database retrieval system