Telluria mixta: P0M04_21340 Help Entry P0M04_21340       CDS       T08884                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tmj  Telluria mixta Pathway tmj01100   Metabolic pathways tmj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tmj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P0M04_21340    00074 Mycolic acid biosynthesis     P0M04_21340   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P0M04_21340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Motif Other DBs NCBI-ProteinID:  WEM99390 LinkDB All DBs Position 4786945..4787223 Genome browser AA seq 92 aa AA seqDB search MSRDELFAWVADLLAEMFELDRAALTPASNLYADLDIDSIDAVDLAVKLKQMTGKRLQPE VFKTIRTIGDVVDALVGLAQAEPEPQSEAQAV NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgagccgcgacgaactgttcgcgtgggtcgcggacctgctggctgagatgttcgaactc gatcgcgcggcgctgacccccgcgtcgaacctgtacgcggacctcgacatcgacagcatc gatgccgtcgacctggccgtgaagctcaagcagatgaccggcaagcgcctgcagccggaa gtgttcaagaccatccgcacgatcggcgacgtcgtcgatgcgctggtcggtctcgcacag gccgagccggaaccgcaatccgaagcgcaggccgtctga

DBGET integrated database retrieval system