Tuber melanosporum: GSTUM_00001641001 Help Entry GSTUM_00001641001 CDS       T01282                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism tml  Tuber melanosporum Pathway tml04145   Phagocytosis tml04517   IgSF CAM signaling tml04814   Motor proteins Brite KEGG Orthology (KO) [BR:tml00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     GSTUM_00001641001  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     GSTUM_00001641001   09142 Cell motility    04814 Motor proteins     GSTUM_00001641001  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tml03037]     GSTUM_00001641001    04812 Cytoskeleton proteins [BR:tml04812]     GSTUM_00001641001 Cilium and associated proteins [BR:tml03037]  Motile cilia and associated proteins   Dynein arm    GSTUM_00001641001 Cytoskeleton proteins [BR:tml04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      GSTUM_00001641001 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light DUF1672 Ground-like Motif Other DBs NCBI-GeneID:  9187695 NCBI-ProteinID:  XP_002835859 INRA:  GSTUM_00001641001 UniProt:  D5G673 LinkDB All DBs AA seq 97 aa AA seqDB search MATAPPSTTPEPKTTIKSVDMTEEMSSIAIDVAKKAINSNNVEKDIAQYIKKEFDTKFGS TWHCIVGRNFGSFVTHETKNFIYFYVGHLAVLLFKTA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggctaccgcacccccaagcactacccctgagccgaagactaccatcaagtctgttgat atgacagaggagatgtcttctatcgccatcgacgttgctaagaaagcgataaatagcaac aacgtcgagaaggatattgcccagtatatcaagaaggagtttgacaccaaatttggcagc acatggcactgcattgtcggaagaaacttcggaagttttgttactcatgaaaccaaaaat ttcatctacttctacgtcggacacctcgcagtcttgcttttcaaaactgcgtag

DBGET integrated database retrieval system