Tuber melanosporum: GSTUM_00003253001 Help Entry GSTUM_00003253001 CDS       T01282                                  Name (RefSeq) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism tml  Tuber melanosporum Pathway tml03050   Proteasome tml03440   Homologous recombination Brite KEGG Orthology (KO) [BR:tml00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     GSTUM_00003253001   09124 Replication and repair    03440 Homologous recombination     GSTUM_00003253001  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tml03019]     GSTUM_00003253001    04131 Membrane trafficking [BR:tml04131]     GSTUM_00003253001    03051 Proteasome [BR:tml03051]     GSTUM_00003253001    03400 DNA repair and recombination proteins [BR:tml03400]     GSTUM_00003253001 Messenger RNA biogenesis [BR:tml03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      GSTUM_00003253001 Membrane trafficking [BR:tml04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     GSTUM_00003253001 Proteasome [BR:tml03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      GSTUM_00003253001 DNA repair and recombination proteins [BR:tml03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      GSTUM_00003253001 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DSS1_SEM1 Motif Other DBs NCBI-GeneID:  9182876 NCBI-ProteinID:  XP_002836934 INRA:  GSTUM_00003253001 UniProt:  D5G9D2 LinkDB All DBs AA seq 88 aa AA seqDB search MSSSSKPSKTTDPKDSAADKPKEPQKQALSLEEDDEFEDFPVEDWKESETDVQNPPGGRL WEESWDDDDTTEDFSTQLREELKKNPAK NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtccagttcatcaaaaccatcaaagaccaccgatcccaaggactctgcggctgataag cccaaggagccacagaaacaagcattatcgctggaggaggatgacgagttcgaggacttt cccgtcgaagattggaaggagagcgaaactgatgtacagaatcctcccggtgggagattg tgggaggagagttgggatgatgatgataccactgaggacttttctacccaactgagggaa gagcttaaaaagaaccccgccaaataa

DBGET integrated database retrieval system