Tuber melanosporum: GSTUM_00004394001 Help Entry GSTUM_00004394001 CDS       T01282                                  Name (RefSeq) hypothetical protein   KO K13113   ubiquitin-like protein 5 Organism tml  Tuber melanosporum Brite KEGG Orthology (KO) [BR:tml00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:tml03041]     GSTUM_00004394001   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tml04052]     GSTUM_00004394001 Spliceosome [BR:tml03041]  Complex B   Other components    Complex B specific factors     GSTUM_00004394001 Cytokines and neuropeptides [BR:tml04052]  Neuropeptides   Unclassified    GSTUM_00004394001 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD UN_NPL4 Motif Other DBs NCBI-GeneID:  9183789 NCBI-ProteinID:  XP_002835646 INRA:  GSTUM_00004394001 UniProt:  D5G5L0 LinkDB All DBs AA seq 73 aa AA seqDB search MIEVICNDRLGKKVRVKCEPNDTIGDFKRLVAAQIGTSAEKIVLKKWYNTFKDHITLADY EISNGTSLEMYYS NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaagtaatctgcaacgaccgcctcggcaaaaaagtgcgcgtaaaatgcgaaccg aatgatacgatcggtgactttaaaaggttggtggcggcgcagatagggacttcggcggag aagattgtgctcaagaagtggtacaacacgtttaaggatcacatcaccctggccgattac gagattagcaatgggacttctttggagatgtattacagttga

DBGET integrated database retrieval system