Tuber melanosporum: GSTUM_00010514001 Help Entry GSTUM_00010514001 CDS       T01282                                  Name (RefSeq) hypothetical protein   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism tml  Tuber melanosporum Pathway tml03018   RNA degradation tml03040   Spliceosome Brite KEGG Orthology (KO) [BR:tml00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     GSTUM_00010514001   09123 Folding, sorting and degradation    03018 RNA degradation     GSTUM_00010514001  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tml03019]     GSTUM_00010514001    03041 Spliceosome [BR:tml03041]     GSTUM_00010514001 Messenger RNA biogenesis [BR:tml03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      GSTUM_00010514001   mRNA degradation factors    5'-3' decay     Lsm complex      GSTUM_00010514001 Spliceosome [BR:tml03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     GSTUM_00010514001 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX LSM12_LSM Glyoxalase_7 DUF150_C Motif Other DBs NCBI-GeneID:  9187408 NCBI-ProteinID:  XP_002841390 INRA:  GSTUM_00010514001 UniProt:  D5GM38 LinkDB All DBs AA seq 84 aa AA seqDB search MASQLLPLELVDKCVGSRIWVVMKGDKEFSGTLVGFDDYVNMVLEDVTEYESTGEQVKLK KILLNGNNICMLIPGGDGPGNSAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcatctcaactcctccctctagaacttgtcgataaatgcgtcggctcaagaatctgg gtggtaatgaagggtgacaaggaattcagcggaacattggtcggctttgatgactacgtc aacatggtcctagaagacgtaacagaatatgagagcaccggagaacaagtcaagcttaaa aagatactcttgaatggaaacaatatctgtatgttgattcctggaggtgacggtcccggg aattcggctgcatga

DBGET integrated database retrieval system