Tuber melanosporum: GSTUM_00010887001 Help Entry GSTUM_00010887001 CDS       T01282                                  Name (RefSeq) hypothetical protein   KO K03872   elongin-C Organism tml  Tuber melanosporum Pathway tml04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:tml00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     GSTUM_00010887001  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tml04121]     GSTUM_00010887001    03400 DNA repair and recombination proteins [BR:tml03400]     GSTUM_00010887001 Ubiquitin system [BR:tml04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      GSTUM_00010887001    Cul5 complex      GSTUM_00010887001 DNA repair and recombination proteins [BR:tml03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      GSTUM_00010887001 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  9185135 NCBI-ProteinID:  XP_002841608 INRA:  GSTUM_00010887001 UniProt:  D5GMQ6 LinkDB All DBs AA seq 106 aa AA seqDB search MSTTAPKTQDENSVLLVSNDNHTFILRKSSVMISPAIKSMLDKKSNFEEAQFNRVVFKNM NGVVLEKVCEYFYYREKYRDATDVPDMEIPPELALELLMVADFLCT NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgtcaaccacagcccccaaaacccaagatgaaaactctgtccttctggtctcgaacgac aaccataccttcatcctccgaaaatcttccgtcatgatatcccccgccataaaaagtatg ttggataaaaagagcaattttgaggaagcgcagtttaaccgtgtggttttcaagaatatg aatggggttgtgttggagaaggtttgtgagtacttttattatcgggagaagtatagggat gcaacggacgtgccagatatggagatcccgccagagttggcgctggagttgttgatggtt gcggattttttgtgcacttaa

DBGET integrated database retrieval system