Tuber melanosporum: GSTUM_00011556001 Help Entry GSTUM_00011556001 CDS       T01282                                  Name (RefSeq) hypothetical protein   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism tml  Tuber melanosporum Pathway tml03018   RNA degradation tml03040   Spliceosome Brite KEGG Orthology (KO) [BR:tml00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     GSTUM_00011556001   09123 Folding, sorting and degradation    03018 RNA degradation     GSTUM_00011556001  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tml03019]     GSTUM_00011556001    03041 Spliceosome [BR:tml03041]     GSTUM_00011556001 Messenger RNA biogenesis [BR:tml03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      GSTUM_00011556001   mRNA degradation factors    5'-3' decay     Lsm complex      GSTUM_00011556001 Spliceosome [BR:tml03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     GSTUM_00011556001 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM Gemin6 Motif Other DBs NCBI-GeneID:  9186514 NCBI-ProteinID:  XP_002842020 INRA:  GSTUM_00011556001 UniProt:  D5GNW8 LinkDB All DBs AA seq 99 aa AA seqDB search MSNLQTFVNKTVTIITSDGRTLTGKLMGHDQTTNLILSRTIERIFATPGSEEATQQVEHG LYLIRGDNVAICGLVDEQLEAGIDWSAVRAEPLGGMKHV NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtctaaccttcagaccttcgtcaacaaaaccgtcacaatcataacttcggacggaaga acccttaccggcaagcttatgggtcacgaccaaactaccaacctcatcctttctcgcacc atcgaacgtatctttgcaacacccgggtccgaggaggccacgcaacaagttgaacacgga ttgtatttgattcgtggggataacgttgccatttgcgggcttgtggacgagcagttggag gctgggattgattggtcggcagtgagggcggagccgttgggtgggatgaagcatgtatga

DBGET integrated database retrieval system