Thermotoga maritima MSB8: Tmari_0082 Help Entry Tmari_0082        CDS       T02663                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism tmm  Thermotoga maritima MSB8 Pathway tmm02020   Two-component system tmm02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:tmm00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Tmari_0082  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Tmari_0082  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:tmm02035]     Tmari_0082 Bacterial motility proteins [BR:tmm02035]  Flagellar system   Flagellar assembly proteins    Others     Tmari_0082 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Cytidylate_kin DUF6033 MRP-S26 RedAm-like_C Motif Other DBs NCBI-ProteinID:  AGL49008 LinkDB All DBs Position complement(88715..88993) Genome browser AA seq 92 aa AA seqDB search MIDRINGPRDINPIEGIKKPSVEKSKEKRKKESTDNVELRHVEDVRKFAEEAKNISTVRE QLVEELKKAIESGNYFIDTERLARKILEELSE NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgatagacagaataaacggaccgagagacataaatcccatcgaaggaataaagaagcct tctgtagaaaaatcaaaggagaagaggaaaaaggaaagcaccgataatgtggaacttcga cacgttgaagatgtcagaaaattcgctgaagaggcgaaaaacatctcaactgtccgcgaa cagctggtagaggagctgaaaaaagccatagaaagtgggaattacttcatcgataccgaa agacttgcccgaaaaattctggaggagctgtccgaatga

DBGET integrated database retrieval system