Thermotoga maritima MSB8: Tmari_0881 Help Entry Tmari_0881        CDS       T02663                                  Name (GenBank) Ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism tmm  Thermotoga maritima MSB8 Pathway tmm00020   Citrate cycle (TCA cycle) tmm00720   Other carbon fixation pathways tmm01100   Metabolic pathways tmm01110   Biosynthesis of secondary metabolites tmm01120   Microbial metabolism in diverse environments tmm01200   Carbon metabolism tmm01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:tmm00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Tmari_0881   09102 Energy metabolism    00720 Other carbon fixation pathways     Tmari_0881 Enzymes [BR:tmm01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Tmari_0881 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_7 Fer4_21 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_13 Fer4_3 Fer4_17 Fer4_8 Fer4_15 Fer4_22 Motif Other DBs NCBI-ProteinID:  AGL49806 UniProt:  Q9WZY1 LinkDB All DBs Position complement(902050..902247) Genome browser AA seq 65 aa AA seqDB search MGYKIVVNYDWCKACKLCAWACPTSAITSDEIGKPVTNENKCIGCLKCEKICPDMAIEIV SDENA NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgggttacaagatcgtggtgaattacgactggtgcaaagcgtgtaagctgtgcgcgtgg gcttgtccgactagtgccattacaagcgatgaaataggaaaacccgtgacaaacgaaaac aaatgcatcggatgtttaaaatgtgagaaaatatgtccggatatggccatagaaattgtg agtgatgagaatgcctga

DBGET integrated database retrieval system