Phaeoacremonium minimum: UCRPA7_2833 Help Entry UCRPA7_2833       CDS       T03102                                  Name (RefSeq) putative rho gtpase protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism tmn  Phaeoacremonium minimum Pathway tmn04145   Phagosome tmn04148   Efferocytosis tmn04620   Toll-like receptor signaling pathway tmn05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:tmn00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     UCRPA7_2833    04148 Efferocytosis     UCRPA7_2833  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     UCRPA7_2833  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     UCRPA7_2833  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tmn04131]     UCRPA7_2833   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tmn04147]     UCRPA7_2833    04031 GTP-binding proteins [BR:tmn04031]     UCRPA7_2833 Membrane trafficking [BR:tmn04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     UCRPA7_2833  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     UCRPA7_2833   Macropinocytosis    Ras GTPases     UCRPA7_2833  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     UCRPA7_2833 Exosome [BR:tmn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    UCRPA7_2833   Exosomal proteins of other body fluids (saliva and urine)    UCRPA7_2833   Exosomal proteins of colorectal cancer cells    UCRPA7_2833   Exosomal proteins of bladder cancer cells    UCRPA7_2833 GTP-binding proteins [BR:tmn04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     UCRPA7_2833 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MAM1 Motif Other DBs NCBI-GeneID:  19323122 NCBI-ProteinID:  XP_007913608 UniProt:  R8BQM7 LinkDB All DBs Position Unknown AA seq 199 aa AA seqDB search MAAPGVQSLKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSASVMVDGKPISLGL WDTAGQEDYDRLRPLSYPQTDVFLICFSIVSPPSFDNVKAKWYPEIDHHAPNIPIILVGT KLDLREDPATLESLRQKRMEPVSYDQALVCAKEIRAHKYLECSALTQRNLKSVFDEAIRA VLNPRPQPTKPKGKKCTIL NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atggctgcccctggggtccagtcactcaagtgcgtcgtgacaggtgacggtgccgttggc aagacatgtctgctcatctcctacacaacgaatgccttccccggcgagtatattcccaca gtgttcgataactactctgccagcgttatggtcgatggcaagcctatcagcctgggtcta tgggatactgccggccaagaggattacgaccgactacgaccactctcctaccctcagacc gacgtcttcctaatctgcttctccatcgtgagcccgccctccttcgacaacgtcaaggct aagtggtatcccgagatcgaccatcatgcgcctaacatccccatcatcctcgtcggaacc aagctcgatctccgtgaagaccccgcgacccttgagtctctccgccagaagagaatggag cccgtctcgtacgaccaggctctggtgtgcgcgaaggagatccgagcccataaataccta gagtgctcagctctgacgcagcgaaacctgaagagcgtcttcgacgaggccatccgtgct gttctcaaccctcggccacagcccacgaagcccaagggcaagaagtgcaccatcctgtaa

DBGET integrated database retrieval system