Phaeoacremonium minimum: UCRPA7_8145 Help Entry UCRPA7_8145       CDS       T03102                                  Name (RefSeq) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism tmn  Phaeoacremonium minimum Pathway tmn03050   Proteasome tmn03440   Homologous recombination Brite KEGG Orthology (KO) [BR:tmn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     UCRPA7_8145   09124 Replication and repair    03440 Homologous recombination     UCRPA7_8145  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tmn03019]     UCRPA7_8145    04131 Membrane trafficking [BR:tmn04131]     UCRPA7_8145    03051 Proteasome [BR:tmn03051]     UCRPA7_8145    03400 DNA repair and recombination proteins [BR:tmn03400]     UCRPA7_8145 Messenger RNA biogenesis [BR:tmn03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      UCRPA7_8145 Membrane trafficking [BR:tmn04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     UCRPA7_8145 Proteasome [BR:tmn03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      UCRPA7_8145 DNA repair and recombination proteins [BR:tmn03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      UCRPA7_8145 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DSS1_SEM1 Motif Other DBs NCBI-GeneID:  19328970 NCBI-ProteinID:  XP_007918855 UniProt:  R8BAP3 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MASAQSAAKKDEKPASNEPKPEQTQQKSAAALEEDDEFEDFPVDDWNSEETEAAGGSEAT KHLWEESWDDDDTSDDFSTQLKEELKKVEESKRRR NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcctccgcacagtcagccgcaaagaaggacgagaagcccgcctcgaacgagcccaag cccgagcagacacagcagaagtccgctgctgcgctagaagaggacgacgagtttgaggat ttccctgttgatgactggaactccgaagagaccgaggcagctggcggcagcgaggcgaca aagcacctgtgggaggagtcttgggacgacgatgacacaagcgacgatttctcaacgcag ctgaaggaggagctgaagaaggtcgaagagtccaagagacggcgatga

DBGET integrated database retrieval system