Tistrella mobilis: TMO_0359 Help Entry TMO_0359          CDS       T02128                                  Name (GenBank) Glutaredoxin-related protein   KO K03676   glutaredoxin 3 Organism tmo  Tistrella mobilis Brite KEGG Orthology (KO) [BR:tmo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tmo03110]     TMO_0359 Chaperones and folding catalysts [BR:tmo03110]  Protein folding catalysts   Protein disulfide isomerase    TMO_0359 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like GST_N_2 SH3BGR Thioredoxin_4 Thioredoxin_3 Ribosomal_S6 Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  AFK52198 UniProt:  I3THG0 LinkDB All DBs Position 378845..379105 Genome browser AA seq 86 aa AA seqDB search MAEVIIYSTPICPYCARAKALLERKGVSYTDIDVYGDRSLRAEMTEKAGGRTSVPQIFID GAHVGGCDDLYALERAGKLDPMLGAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtggccgaggtcatcatctattcgacgccgatctgcccctattgcgcacgcgccaaggcg ctgctggagcggaagggcgtgagctacaccgatatcgacgtctatggcgaccggtcgctc cgtgcggaaatgaccgagaaggccggcgggcgtaccagcgtgccgcagatcttcatcgac ggcgcccatgtcggcggctgtgacgatctttatgcgctggagcgtgccggcaaactggat ccgatgctgggggcggcgtga

DBGET integrated database retrieval system