Tistrella mobilis: TMO_1697 Help Entry TMO_1697          CDS       T02128                                  Symbol groS Name (GenBank) chaperonin   KO K04078   chaperonin GroES Organism tmo  Tistrella mobilis Brite KEGG Orthology (KO) [BR:tmo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tmo03110]     TMO_1697 (groS)    03029 Mitochondrial biogenesis [BR:tmo03029]     TMO_1697 (groS) Chaperones and folding catalysts [BR:tmo03110]  Heat shock proteins   HSP10    TMO_1697 (groS) Mitochondrial biogenesis [BR:tmo03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     TMO_1697 (groS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Peptidase_M23 Motif Other DBs NCBI-ProteinID:  AFK53536 UniProt:  I3TL98 LinkDB All DBs Position complement(1877004..1877294) Genome browser AA seq 96 aa AA seqDB search MAIRPLHDRVVVRPIEQEQKTAGGIIIPDTAKEKPQQGEVIAVGNGVRGEDGKVVALDVK VGDRVLYGKWSGTEVKVDGQDVLILKEQDIFGVIEG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgattcgtccgctgcatgatcgcgtcgttgtgcgcccgatcgagcaggagcagaag acggccggcggcatcatcatccccgacaccgccaaggagaagccgcagcagggcgaagtc attgcggtcggcaatggcgtccgcggcgaggacggcaaggttgtggcgctcgacgtgaag gtcggcgaccgcgtcctctacggcaagtggtcgggcaccgaggtgaaggtcgacggccag gacgttctgatcctgaaggagcaggacatcttcggcgtgatcgagggctga

DBGET integrated database retrieval system