Tenebrio molitor (yellow mealworm): 138133104 Help Entry 138133104         CDS       T10686                                  Name (RefSeq) LIRP-like   KO K04526   insulin Organism tmol  Tenebrio molitor (yellow mealworm) Pathway tmol04068   FoxO signaling pathway tmol04081   Hormone signaling tmol04140   Autophagy - animal tmol04150   mTOR signaling pathway tmol04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:tmol00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     138133104    04150 mTOR signaling pathway     138133104   09133 Signaling molecules and interaction    04081 Hormone signaling     138133104  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     138133104  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     138133104  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tmol04052]     138133104 Cytokines and neuropeptides [BR:tmol04052]  Neuropeptides   Unclassified    138133104 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  138133104 NCBI-ProteinID:  XP_068907010 UniProt:  A0A977XCX0 LinkDB All DBs Position 6:4129627..4130053 Genome browser AA seq 125 aa AA seqDB search MDQRLLLLFLLVNSISVWSSPHKLHSINKRAEFFCGSKLSEALYMVCKGSYNSPTKKSIN DLFAYEYDYFPSESDEDNQLDFPFLERDTANSFLPIRSRRRRAGIVNECCRNPCTLQHLS LYCGS NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggatcagcgcctgctactcttgttcctcctggtcaacagcatctcggtgtggtcgtcg ccccacaagctccactcgatcaacaagagggcggagttcttctgcgggtccaagctgtcg gaggccctctacatggtgtgcaaaggcagctacaactctcccaccaagaagtcgataaac gacttgttcgcctacgaatacgactacttcccaagcgagagcgacgaagacaaccaacta gatttccccttcctggagagagacaccgccaattcgtttctaccgatcaggtccaggaga agaagagcaggaatcgtgaacgaatgctgccgcaatccgtgcactcttcagcacttgagt ctctattgcggatcgtaa

DBGET integrated database retrieval system