Tenebrio molitor (yellow mealworm): 138133370 Help Entry 138133370         CDS       T10686                                  Name (RefSeq) uncharacterized protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism tmol  Tenebrio molitor (yellow mealworm) Pathway tmol04013   MAPK signaling pathway - fly tmol04145   Phagosome tmol04148   Efferocytosis tmol04310   Wnt signaling pathway tmol04620   Toll-like receptor signaling pathway tmol05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:tmol00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     138133370    04310 Wnt signaling pathway     138133370  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     138133370    04148 Efferocytosis     138133370  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     138133370  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     138133370  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tmol04131]     138133370   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tmol04147]     138133370    04031 GTP-binding proteins [BR:tmol04031]     138133370 Membrane trafficking [BR:tmol04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     138133370  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     138133370   Macropinocytosis    Ras GTPases     138133370  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     138133370 Exosome [BR:tmol04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    138133370   Exosomal proteins of other body fluids (saliva and urine)    138133370   Exosomal proteins of colorectal cancer cells    138133370   Exosomal proteins of bladder cancer cells    138133370 GTP-binding proteins [BR:tmol04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     138133370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Motif Other DBs NCBI-GeneID:  138133370 NCBI-ProteinID:  XP_068907368 LinkDB All DBs Position 1:43004474..43007790 Genome browser AA seq 177 aa AA seqDB search MSKYLTLVAVGDDNSNKTELLLKYTGNHCARYNKFVVPRFKNNVQSIVVDHVCWTVCFVD AESDDHYSVLRRAAYEKADCILLCYSVKSRSSFKSVYKKWCIEVRKHAPLVPIILIATDT EARSAAAAAATVSTEQGENLKLLIGAYAFIECSVEHFLGIDDIFIEAVRSTYQRTKF NT seq 534 nt NT seq  +upstreamnt  +downstreamnt atgtcaaagtacctgactttggtggcggtcggcgacgacaacagcaataaaaccgaacta ctgctcaaatacacgggcaaccattgtgcacgctacaacaaattcgtcgtaccgagattt aaaaataatgtacaaagcattgttgtcgaccacgtttgttggactgtctgctttgtcgat gcggagtctgacgaccactacagcgtcctacgacgagcagcctacgagaaagccgactgc atcttgctctgctactctgttaaatctcgttcctccttcaagagtgtttacaagaaatgg tgcatcgaagtgaggaagcatgcacctctcgttcccattatactaatcgctaccgacacc gaagctcgcagcgccgccgccgccgccgccactgtctccaccgaacaaggcgaaaatttg aaattacttatcggagcttacgcctttatagagtgttcagtcgaacatttcctcggcata gacgatatatttatagaagccgtgcggagcacttatcaacgaacgaagttttaa

DBGET integrated database retrieval system