Tenebrio molitor (yellow mealworm): 138135067 Help Entry 138135067         CDS       T10686                                  Name (RefSeq) cdc42 homolog   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism tmol  Tenebrio molitor (yellow mealworm) Pathway tmol04013   MAPK signaling pathway - fly tmol04145   Phagosome tmol04148   Efferocytosis tmol04310   Wnt signaling pathway tmol04620   Toll-like receptor signaling pathway tmol05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:tmol00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     138135067    04310 Wnt signaling pathway     138135067  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     138135067    04148 Efferocytosis     138135067  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     138135067  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     138135067  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tmol04131]     138135067   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tmol04147]     138135067    04031 GTP-binding proteins [BR:tmol04031]     138135067 Membrane trafficking [BR:tmol04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     138135067  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     138135067   Macropinocytosis    Ras GTPases     138135067  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     138135067 Exosome [BR:tmol04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    138135067   Exosomal proteins of other body fluids (saliva and urine)    138135067   Exosomal proteins of colorectal cancer cells    138135067   Exosomal proteins of bladder cancer cells    138135067 GTP-binding proteins [BR:tmol04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     138135067 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  138135067 NCBI-ProteinID:  XP_068909804 LinkDB All DBs Position 7:6476309..6477631 Genome browser AA seq 180 aa AA seqDB search MKTIRITVVGDGGAGKTCMLIVYKDRKFDERYIPTVFDVYSMTVPINQKNHTVILQDTAG QEEFDKLRQLAYKETDVFVLCYSVDDVNSWDNVKEKWAPELKRCCPRAKLILAGTKSDLV SKRVVSEKDGTRLAKQIKADGFIENSAKLGKNIDETICLAITVYMNSITKRDSSSSCALI NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgaaaacgatcagaataacggtggtgggtgacggtggcgctggtaaaacctgcatgtta atagtttacaaagacagaaagttcgatgaaagatacatccccacagtatttgacgtttac tcaatgaccgtaccgataaaccagaaaaaccacactgttattttacaagacacggctggt caagaagaatttgacaagttacgtcaactggcgtacaaagaaactgacgtttttgtattg tgctattcagtagatgatgttaactcttgggacaacgtgaaagaaaaatgggccccggaa ctgaaaagatgttgtcctagagcgaaactgatattagctggaacgaaaagcgatcttgtt tccaaaagagtggtgagcgaaaaagacggtactagattggctaaacagataaaggcggac ggatttattgaaaattcggcgaaattaggaaaaaatattgacgagactatttgtttagca attacggtctacatgaacagcatcactaaaagagacagcagcagcagttgcgcactaatc taa

DBGET integrated database retrieval system