KEGG   Tenebrio molitor (yellow mealworm): 138135340
Entry
138135340         CDS       T10686                                 
Symbol
Tim17b
Name
(RefSeq) mitochondrial import inner membrane translocase subunit Tim17-B
  KO
K17795  mitochondrial import inner membrane translocase subunit TIM17
Organism
tmol  Tenebrio molitor (yellow mealworm)
Brite
KEGG Orthology (KO) [BR:tmol00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tmol03029]
    138135340 (Tim17b)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tmol02000]
    138135340 (Tim17b)
Mitochondrial biogenesis [BR:tmol03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    138135340 (Tim17b)
Transporters [BR:tmol02000]
 Other transporters
  Primary active transporters [TC:3]
   138135340 (Tim17b)
SSDB
Motif
Pfam: Tim17
Other DBs
NCBI-GeneID: 138135340
NCBI-ProteinID: XP_068910144
LinkDB
Position
7:10566582..10567492
AA seq 166 aa
MEEYTREPCPWRIVDDCGGAFTMGLIGGGVFQSIKGFRNAPSGLNRRLVGSLAAIKQRSP
IIAGNFAVWGGMFSTIDCALIHIRKKEDPWNSIISGAATGGILAARNGLPAMAGSAFIGG
VLLALIEGVGILFTRLSAEQFQPQLPPMDDPSQLRSQQGSEGYSFQ
NT seq 501 nt   +upstreamnt  +downstreamnt
atggaagaatacacaagagagccgtgcccatggaggatagtagacgactgtgggggtgct
ttcaccatgggcctgatcgggggcggcgtttttcagagtattaaaggatttcgcaacgcg
ccgtcaggtctcaacagacgtctagtcggcagtttggccgctataaagcaaaggtcgcct
atcatagcaggtaatttcgcggtttggggtggtatgttttcgacgatcgattgtgctttg
attcacatcaggaagaaggaagatccctggaattctattataagtggggccgccacgggc
ggaatcttggccgccaggaacggactgccggctatggcgggcagcgctttcattggtggc
gttcttttagctttaattgaaggtgtaggaatattgtttacaaggttgtctgctgaacaa
ttccagccgcaactgcccccaatggacgacccctcacagttaagatctcagcaaggttct
gagggttactcgtttcagtag

DBGET integrated database retrieval system