Tenebrio molitor (yellow mealworm): 138135622 Help Entry 138135622         CDS       T10686                                  Symbol Eh Name (RefSeq) eclosion hormone   KO K28249   eclosion hormone Organism tmol  Tenebrio molitor (yellow mealworm) Brite KEGG Orthology (KO) [BR:tmol00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tmol04052]     138135622 (Eh) Cytokines and neuropeptides [BR:tmol04052]  Neuropeptides   Unclassified    138135622 (Eh) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Eclosion Motif Other DBs NCBI-GeneID:  138135622 NCBI-ProteinID:  XP_068910503 UniProt:  A0A977SQ99 LinkDB All DBs Position 7:complement(11186332..11186957) Genome browser AA seq 81 aa AA seqDB search MACRTRNLLGAALFVLLTSAFLLTEANPIGVCIRNCAQCKKMFGPYFEGQLCADACVKFK GKIIPDCEDIASIAPFLNKFE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcctgcaggacgagaaaccttctgggggccgccctgttcgtcctcctcacctcagct ttcctcctgactgaggccaatccgatcggagtctgcatacgcaactgcgcccagtgcaag aagatgtttggtccttacttcgaaggacaattgtgcgccgacgcttgcgtcaaattcaaa ggcaaaatcattccggattgcgaagatatcgcttcgattgcgccctttctgaacaagttc gaatga

DBGET integrated database retrieval system