Tenebrio molitor (yellow mealworm): 138141388 Help Entry 138141388         CDS       T10686                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism tmol  Tenebrio molitor (yellow mealworm) Pathway tmol04013   MAPK signaling pathway - fly tmol04145   Phagosome tmol04148   Efferocytosis tmol04310   Wnt signaling pathway tmol04517   IgSF CAM signaling tmol04518   Integrin signaling tmol04620   Toll-like receptor signaling pathway tmol05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:tmol00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     138141388    04310 Wnt signaling pathway     138141388   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     138141388    04518 Integrin signaling     138141388  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     138141388    04148 Efferocytosis     138141388  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     138141388  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     138141388  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tmol04131]     138141388   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tmol04147]     138141388    04031 GTP-binding proteins [BR:tmol04031]     138141388 Membrane trafficking [BR:tmol04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     138141388  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     138141388   Macropinocytosis    Ras GTPases     138141388  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     138141388 Exosome [BR:tmol04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    138141388   Exosomal proteins of other body fluids (saliva and urine)    138141388   Exosomal proteins of colorectal cancer cells    138141388   Exosomal proteins of bladder cancer cells    138141388 GTP-binding proteins [BR:tmol04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     138141388 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  138141388 NCBI-ProteinID:  XP_068918209 LinkDB All DBs Position 1:31850424..31852947 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR DDRGTIEKLKDKKLTPITYPQGLAMAKEISAVKYLECSALTQKGLKTVFDEAIRAVLCPV MQVKPKRKCVLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagctattaagtgcgttgtcgttggtgacggtgctgttggtaaaacatgtctgctg ataagttacacaacaaacgcctttccaggcgaatatattccaactgtatttgacaattat tctgcaaatgtaatggtggatggaaaacctattaacctaggtctttgggatacagcaggt caagaagattatgataggttaaggccactttcttatccacaaacggacgtgttcctgatc tgtttttctttggtgaatccagcatcttttgaaaacgttcgagctaaatggtatccagaa gtcagacaccattgtccaaacacaccaatcattctagttgggacaaaattagatttgcgt gatgatagaggtacaattgaaaagctaaaggataaaaaacttacacccatcacatatcca caaggtttggcgatggcaaaagaaatcagcgctgtgaaatatttagaatgttcagcactc acacagaaaggactgaaaactgtttttgatgaggctattagagcagttctttgccctgtc atgcaagttaaacccaagcgtaaatgtgtattattgtaa

DBGET integrated database retrieval system