Tenebrio molitor (yellow mealworm): 138141398 Help Entry 138141398         CDS       T10686                                  Name (RefSeq) LIRP-like   KO K04526   insulin Organism tmol  Tenebrio molitor (yellow mealworm) Pathway tmol04068   FoxO signaling pathway tmol04081   Hormone signaling tmol04140   Autophagy - animal tmol04150   mTOR signaling pathway tmol04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:tmol00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     138141398    04150 mTOR signaling pathway     138141398   09133 Signaling molecules and interaction    04081 Hormone signaling     138141398  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     138141398  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     138141398  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tmol04052]     138141398 Cytokines and neuropeptides [BR:tmol04052]  Neuropeptides   Unclassified    138141398 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  138141398 NCBI-ProteinID:  XP_068918212 LinkDB All DBs Position 1:8614512..8615138 Genome browser AA seq 132 aa AA seqDB search MAVPQLLPTKMDNRVTFVFFLLNIIYVWCTPHMASFMNKREVFCGPKLSDALALVCRGNY NPPSKKSMNDLLTYNTYDELFPSENDDDLDFPFIQKEAANSFLPMRFARSRGVVDECCKK PCTYRHLTLYCG NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggcagtaccgcaactactcccaactaagatggacaaccgcgtaacgtttgtattcttt ttgctaaatatcatttatgtatggtgtacacctcatatggcaagtttcatgaacaaacgg gaagttttctgcggtccgaaactatcagacgctttggctctcgtctgcagagggaattac aaccctcctagcaaaaagtcaatgaatgacttgctcacttataacacgtacgacgagctt ttccccagtgagaatgacgacgatttggatttcccgtttatccagaaggaggcggccaac tcgtttttacccatgaggtttgcacgaagcaggggagtggtggacgaatgttgcaagaag ccgtgcacttacaggcatttgactctttactgtggataa

DBGET integrated database retrieval system