Thermotoga maritima Tma100: THMB_0012 Help Entry THMB_0012         CDS       T03900                                  Name (GenBank) pyruvate synthase   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism tmq  Thermotoga maritima Tma100 Pathway tmq00010   Glycolysis / Gluconeogenesis tmq00020   Citrate cycle (TCA cycle) tmq00620   Pyruvate metabolism tmq00633   Nitrotoluene degradation tmq00640   Propanoate metabolism tmq00650   Butanoate metabolism tmq00680   Methane metabolism tmq00720   Other carbon fixation pathways tmq01100   Metabolic pathways tmq01110   Biosynthesis of secondary metabolites tmq01120   Microbial metabolism in diverse environments tmq01200   Carbon metabolism tmq01210   2-Oxocarboxylic acid metabolism Module tmq_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:tmq00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     THMB_0012    00020 Citrate cycle (TCA cycle)     THMB_0012    00620 Pyruvate metabolism     THMB_0012    00640 Propanoate metabolism     THMB_0012    00650 Butanoate metabolism     THMB_0012   09102 Energy metabolism    00720 Other carbon fixation pathways     THMB_0012    00680 Methane metabolism     THMB_0012   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     THMB_0012 Enzymes [BR:tmq01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      THMB_0012 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_6 Fer4_9 Fer4_7 Fer4_10 Fer4_16 Fer4_2 Fer4_4 Fer4_13 Fer4_8 Fer4_3 Fer4_18 Fer4_17 Fer4_15 Fer4_22 Motif Other DBs NCBI-ProteinID:  AKE29698 LinkDB All DBs Position 13836..14135 Genome browser AA seq 99 aa AA seqDB search MSLKSWKEIPIGGVIDKPGTAREYKTGAWRVMRPILHKEKCIDCMFCWLYCPDQAIIQEG GIMKGFNYDYCKGCGLCANVCPKQAIEMRPETEFLSEEG NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtctcttaaaagctggaaggaaattcccattggaggagtcatcgacaaaccgggaaca gcaagagaatacaaaacaggtgcctggcgtgtgatgagacctattcttcacaaagagaaa tgtatagactgtatgttctgctggctctactgtccagatcaagcgatcatccaagaaggc ggaataatgaaaggtttcaactacgactactgtaaaggatgcggactctgtgcgaacgta tgtccaaagcaggccatagagatgagacctgagactgagtttctgagcgaggagggatga

DBGET integrated database retrieval system