Thermotoga maritima Tma100: THMB_0901 Help Entry THMB_0901         CDS       T03900                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism tmq  Thermotoga maritima Tma100 Pathway tmq00020   Citrate cycle (TCA cycle) tmq00720   Other carbon fixation pathways tmq01100   Metabolic pathways tmq01110   Biosynthesis of secondary metabolites tmq01120   Microbial metabolism in diverse environments tmq01200   Carbon metabolism tmq01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:tmq00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     THMB_0901   09102 Energy metabolism    00720 Other carbon fixation pathways     THMB_0901 Enzymes [BR:tmq01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      THMB_0901 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_7 Fer4_21 Fer4_10 Fer4_9 Fer4_16 LdpA_Fe-S-bd Fer4_4 Fer4_13 NosR Fer4_3 Fer4_17 Fer4_8 Fer4_15 Fer4_22 Motif Other DBs NCBI-ProteinID:  AKE30532 LinkDB All DBs Position complement(902049..902246) Genome browser AA seq 65 aa AA seqDB search MGYKIVVNYDWCKACKLCAWACPTSAITSDEIGKPVTNENKCIGCLKCEKICPDMAIEIV SDENA NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgggttacaagatcgtggtgaattacgactggtgcaaagcgtgtaagctgtgcgcgtgg gcttgtccgactagtgccattacaagcgatgaaataggaaaacccgtgacaaacgaaaac aaatgcatcggatgtttaaaatgtgagaaaatatgtccggatatggccatagaaattgtg agtgatgagaatgcctga

DBGET integrated database retrieval system